HPA034701

HEMK1 antibody from MilliporeSigma / Merck KGaA
MTQ1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA034701
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA034701, RRID:AB_10601429
Product name
Anti-HEMK1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA034701
Antibody type
Polyclonal
Antigen
HemK methyltransferase family member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QYILGEWDFQGLSLRMVPPVFIPRPETEELVEWVL
EEVAQRSHAVGSPGSPLILEVGCGSGAISLSLLSQ
LPQSRVIAVDKREAAISLTHE
Storage
-20C
Provider Type Product Number
- No reagents -