HPA056833

HSD17B3 antibody from Atlas Antibodies
SDR12C2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA056833
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA056833, RRID:AB_2683252
Product name
Anti-HSD17B3
Provider product page
Atlas Antibodies - HPA056833
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NVGILPNLLPSHFLNAPDEIQSLIHCNITSVVKMT
QLILKHMESRQKGLIL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -