Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003293-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003293-A01, RRID:AB_535233
- Product name
- HSD17B3 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant HSD17B3.
- Antigen sequence
RCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKA
YSFELAKRGLNVVLISRTLEKLEAIATEIERTTGR
SVKIIQADFTKDDIYEHIKEK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A low carbohydrate, high protein diet suppresses intratumoral androgen synthesis and slows castration-resistant prostate tumor growth in mice.
Pomegranate extracts impact the androgen biosynthesis pathways in prostate cancer models in vitro and in vivo.
Androgen levels increase by intratumoral de novo steroidogenesis during progression of castration-resistant prostate cancer.
Fokidis HB, Yieng Chin M, Ho VW, Adomat HH, Soma KK, Fazli L, Nip KM, Cox M, Krystal G, Zoubeidi A, Tomlinson Guns ES
The Journal of steroid biochemistry and molecular biology 2015 Jun;150:35-45
The Journal of steroid biochemistry and molecular biology 2015 Jun;150:35-45
Pomegranate extracts impact the androgen biosynthesis pathways in prostate cancer models in vitro and in vivo.
Ming DS, Pham S, Deb S, Chin MY, Kharmate G, Adomat H, Beheshti EH, Locke J, Guns ET
The Journal of steroid biochemistry and molecular biology 2014 Sep;143:19-28
The Journal of steroid biochemistry and molecular biology 2014 Sep;143:19-28
Androgen levels increase by intratumoral de novo steroidogenesis during progression of castration-resistant prostate cancer.
Locke JA, Guns ES, Lubik AA, Adomat HH, Hendy SC, Wood CA, Ettinger SL, Gleave ME, Nelson CC
Cancer research 2008 Aug 1;68(15):6407-15
Cancer research 2008 Aug 1;68(15):6407-15
No comments: Submit comment
No validations: Submit validation data