H00003293-A01

HSD17B3 antibody from Abnova Corporation
SDR12C2
No application information provided.

Antibody data

Product number
H00003293-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003293-A01, RRID:AB_535233
Product name
HSD17B3 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00003293-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant HSD17B3.
Antigen sequence
RCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKA
YSFELAKRGLNVVLISRTLEKLEAIATEIERTTGR
SVKIIQADFTKDDIYEHIKEK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -