HPA015307

HSD17B3 antibody from Sigma-Aldrich
SDR12C2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015307
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015307, RRID:AB_1844349
Product name
Anti-HSD17B3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015307
Antibody type
Polyclonal
Antigen
Testosterone 17-beta-dehydrogenase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAM
TKYLNTNVITKTADEFVKESLNYVTIGGETCGC
Storage
-20C
Provider Type Product Number
- No reagents -