Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA015307 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-HSD17B3
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAM
TKYLNTNVITKTADEFVKESLNYVTIGGETCGC- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Immunoexpression of aromatase cytochrome P450 and 17β-hydroxysteroid dehydrogenase in women’s ovaries after menopause
Regulation of steroidogenesis in a primary pigmented nodular adrenocortical disease-associated adenoma leading to virilization and subclinical Cushing's syndrome
Brodowska A, Brodowski J, Laszczyńska M, Słuczanowska-Głąbowska S, Rumianowski B, Rotter I, Starczewski A, Ratajczak M
Journal of Ovarian Research 2014;7(1)
Journal of Ovarian Research 2014;7(1)
Regulation of steroidogenesis in a primary pigmented nodular adrenocortical disease-associated adenoma leading to virilization and subclinical Cushing's syndrome
Hofland J, de Herder W, Derks L, Hofland L, van Koetsveld P, de Krijger R, van Nederveen F, Horvath A, Stratakis C, de Jong F, Feelders R
European Journal of Endocrinology 2013;168(1):67-74
European Journal of Endocrinology 2013;168(1):67-74
No comments: Submit comment
No validations: Submit validation data