Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007867-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007867-M01, RRID:AB_530119
- Product name
- MAPKAPK3 monoclonal antibody (M01), clone 3F4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MAPKAPK3.
- Antigen sequence
EVSEDAKQLIRLLLKTDPTERLTITQFMNHPWINQ
SMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALAT
MRVDYDQVKIKDLKTSNNRLLNKRRKKQAGSSSAS
QGCNNQ- Isotype
- IgG
- Antibody clone number
- 3F4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MAPKAPK3 monoclonal antibody (M01), clone 3F4. Western Blot analysis of MAPKAPK3 expression in NIH/3T3 ( Cat # L018V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MAPKAPK3 expression in transfected 293T cell line by MAPKAPK3 monoclonal antibody (M01), clone 3F4.Lane 1: MAPKAPK3 transfected lysate (Predicted MW: 43 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MAPKAPK3 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of MAPKAPK3 transfected lysate using anti-MAPKAPK3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MAPKAPK3 monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol