Explore
Validate
LearnAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002035-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002035-A01, RRID:AB_462843
- Product name
- EPB41 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant EPB41.
- Antigen sequence
IEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSL
SSAETQPAQEELREDPDFEIKEGEGLEECSKIEVK
EESPQSKAETELKASQKPIRKHRNMHCKVSLLDDT
VYECV- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Freely turning over palmitate in erythrocyte membrane proteins is not responsible for the anchoring of lipid rafts to the spectrin skeleton: a study with bio-orthogonal chemical probes.
On the association of lipid rafts to the spectrin skeleton in human erythrocytes.
Ciana A, Achilli C, Hannoush RN, Risso A, Balduini C, Minetti G
Biochimica et biophysica acta 2013 Mar;1828(3):924-31
Biochimica et biophysica acta 2013 Mar;1828(3):924-31
On the association of lipid rafts to the spectrin skeleton in human erythrocytes.
Ciana A, Achilli C, Balduini C, Minetti G
Biochimica et biophysica acta 2011 Jan;1808(1):183-90
Biochimica et biophysica acta 2011 Jan;1808(1):183-90
No comments: Submit comment
No validations: Submit validation data