HPA003015

BNIP3 antibody from Sigma-Aldrich
Nip3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003015
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003015, RRID:AB_1078290
Product name
Anti-BNIP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003015
Antibody type
Polyclonal
Antigen
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPAS
VSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRS
QTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKE
VESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRT
ATLSMRNTSVMKKG
Storage
-20C
Provider Type Product Number
- No reagents -