HPA003073

CSDC2 antibody from Sigma-Aldrich
PIPPin
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003073
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003073, RRID:AB_1078578
Product name
Anti-CSDC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003073
Antibody type
Polyclonal
Antigen
Cold shock domain-containing protein C2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTY
SATARASAGPVFKGVCKQFSRSQGHGFITPENGSE
DIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQ
Storage
-20C
Provider Type Product Number
- No reagents -