HPA014861

SLC31A2 antibody from Sigma-Aldrich
COPT2, CTR2, hCTR2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014861
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014861, RRID:AB_1857098
Product name
Anti-SLC31A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014861
Antibody type
Polyclonal
Antigen
Probable low affinity copper uptake protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDS
AGSDSFPVGRTHHRWYLC
Storage
-20C
Provider Type Product Number
- No reagents -