HPA014861

SLC31A2 antibody from Atlas Antibodies
COPT2, CTR2, hCTR2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014861
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014861, RRID:AB_1235649
Product name
Anti-SLC31A2
Provider product page
Atlas Antibodies - HPA014861
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDS
AGSDSFPVGRTHHRWYLC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -