H00051184-B01P

GPN3 antibody from Abnova Corporation
ATPBD1C, MGC14560

Antibody data

Product number
H00051184-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051184-B01P, RRID:AB_1571564
Product name
ATPBD1C purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00051184-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ATPBD1C protein.
Antigen sequence
MPRYAQLVMGPAGSGKSTYCATMVQHCEALNRSVQ
VVNLDPAAEHFNYSVMADIRELIEVDDVMEDDSLR
FGPNGGLVFCMEYFANNFDWLENCLGHVEDDYILF
DCPGQIELYTHLPVMKQLVQQLEQWEFRVCGVFLV
DSQFMVESFKFISGILAALSAMISLEIPQVNIMTK
MDLLSKKAKKEIEKFLDPDMYSLLEDSTSDLRSKK
FKKLTKAICGLIDDYSMVRFLPYDQSDEESMNIAL
QHIDFAIQYGEDLEFKEPKEREDESSSMFDEYFQE
CQDE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -