HPA063699

YIPF3 antibody from Atlas Antibodies
C6orf109, dJ337H4.3, DKFZp566C243, FinGER3, KLIP1

Antibody data

Product number
HPA063699
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA063699, RRID:AB_2685095
Product name
Anti-YIPF3
Provider product page
Atlas Antibodies - HPA063699
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ARNGAGPEWGGFEENIQGGGSAVIDMENMDDTSGS
SFEDMGELHQRLREEEVDADAADAAAAEEEDGEFL
GM
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.