Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA039748 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA039748, RRID:AB_10674426
- Product name
- Anti-VPS29
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
AGHRLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQ
HILCTGNLCTKESYDYLKTLAGDVHIVRGDFDENL
NYPEQKVVTVGQFKIGLIHGHQVIPW- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Actin polymerization in the endosomal pathway, but not on the Coxiella-containing vacuole, is essential for pathogen growth
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Roy C, Miller H, Larson C, Heinzen R
PLOS Pathogens 2018;14(4):e1007005
PLOS Pathogens 2018;14(4):e1007005
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013;10(4):315-323
Nature Methods 2013;10(4):315-323
No comments: Submit comment
No validations: Submit validation data