Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109260 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Tubulointerstitial Nephritis Antigen (TINAG) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the middle region of human TINAG
- Description
- Immunoaffinity column
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
VAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCN
SGSIDRAWWYLRKRG- Epitope
- Middle Region
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C for one month or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or (in aliquots) at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human PANC1; WB Suggested Anti-TINAG Antibody Titration: 0.2-1 ug/ml. Positive Control: PANC1 cell lysate; TINAG antibody - middle region (AP46155PU-N) in Human PANC1 cells using Western Blot