Antibody data

Product number
PAB20779
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20779, RRID:AB_10967765
Product name
KCNS3 polyclonal antibody
Provider product page
Abnova Corporation - PAB20779
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant KCNS3.
Antigen sequence
KDIDVDQCSEDAPEKCHELPYFNIRDIYAQRMHAF
ITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLE
NCTA
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -