HPA014864

KCNS3 antibody from Sigma-Aldrich
Kv9.3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014864
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014864, RRID:AB_1852155
Product name
Anti-KCNS3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014864
Antibody type
Polyclonal
Antigen
Potassium voltage-gated channel subfamily S member 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KDIDVDQCSEDAPEKCHELPYFNIRDIYAQRMHAF
ITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLE
NCTA
Storage
-20C
Provider Type Product Number
- No reagents -