HPA014864

KCNS3 antibody from Atlas Antibodies
Kv9.3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014864
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014864, RRID:AB_1852155
Product name
Anti-KCNS3
Provider product page
Atlas Antibodies - HPA014864
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KDIDVDQCSEDAPEKCHELPYFNIRDIYAQRMHAF
ITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLE
NCTA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -