Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB20767 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB20767, RRID:AB_10967230
- Product name
- AQP4 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant AQP4.
- Antigen sequence
CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQV
ETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSS
V- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references Neuromyelitis optica spectrum disorder as a paraneoplastic manifestation of lung adenocarcinoma expressing aquaporin-4.
Iorio R, Rindi G, Erra C, Damato V, Ferilli M, Sabatelli M
Multiple sclerosis (Houndmills, Basingstoke, England) 2015 May;21(6):791-4
Multiple sclerosis (Houndmills, Basingstoke, England) 2015 May;21(6):791-4
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with AQP4 polyclonal antibody (Cat # PAB20767).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of cell lysates with AQP4 polyclonal antibody (Cat # PAB20767).Lane 1 : NIH/3T3Lane 2 : NBT-II
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach with AQP4 polyclonal antibody (Cat # PAB20767) shows strong cytoplasmic and membranous positivity in glandular cells at 1:2500-1:5000 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)