HPA014784

AQP4 antibody from Atlas Antibodies
MIWC
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014784
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014784, RRID:AB_1233475
Product name
Anti-AQP4
Provider product page
Atlas Antibodies - HPA014784
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQV
ETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSS
V
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -