Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503908 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase-Like 1 (HMGCLL1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HMGCLL1 antibody: synthetic peptide directed towards the N terminal of human HMGCLL1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPA
QETSQ LSGLPEFVKI- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references 3-Hydroxy-3-methylglutaryl coenzyme A lyase (HL). Cloning of human and chicken liver HL cDNAs and characterization of a mutation causing human HL deficiency.
Mitchell GA, Robert MF, Hruz PW, Wang S, Fontaine G, Behnke CE, Mende-Mueller LM, Schappert K, Lee C, Gibson KM, Miziorko HM
The Journal of biological chemistry 1993 Feb 25;268(6):4376-81
The Journal of biological chemistry 1993 Feb 25;268(6):4376-81
No comments: Submit comment
No validations: Submit validation data