HPA015997

PIGG antibody from Sigma-Aldrich
FLJ20265, GPI7, LAS21
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015997
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015997, RRID:AB_2164679
Product name
Anti-PIGG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015997
Antibody type
Polyclonal
Antigen
GPI ethanolamine phosphate transferase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VEYDGTTSFFVSDYTEVDNNVTRHLDKVLKRGDWD
ILILHYLGLDHIGHISGPNSPLIGQKLSEMDSVLM
KIHTSLQSKERETPLPNLLVLCGDHGMSETGSHGA
SSTEEVNTPLILISSAFERKPGDIRHPKHVQQTDV
A
Storage
-20C
Provider Type Product Number
- No reagents -