HPA034810

ASPRV1 antibody from MilliporeSigma / Merck KGaA
FLJ25084, SASPase, Taps
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA034810
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA034810, RRID:AB_10601456
Product name
Anti-ASPRV1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA034810
Antibody type
Polyclonal
Antigen
aspartic peptidase, retroviral-like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SHLPKEIVFANSMGKGYYLKGKIGKVPVRFLVDSG
AQVSVVHPNLWEEVTDGDLDTLQPFENVVKVANGA
EMKILGVWDTAVSL
Storage
-20C
Provider Type Product Number
- No reagents -