H00000667-M01
antibody from Abnova Corporation
Targeting: DST
BP240, BPA, BPAG1, CATX-15, FLJ13425, FLJ21489, FLJ30627, FLJ32235, KIAA0728, MACF2
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000667-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000667-M01, RRID:AB_489901
- Product name
- DST monoclonal antibody (M01), clone 1B10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DST.
- Antigen sequence
EDKLILAGNALQSDSKRLESGVQFQNEAEIAGYIL
ECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLR
DEIMALRNECSSVYSKGRILTTEQTKLMIS- Isotype
- IgG
- Antibody clone number
- 1B10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Dystonin/Bpag1 is a necessary endoplasmic reticulum/nuclear envelope protein in sensory neurons.
Young KG, Kothary R
Experimental cell research 2008 Sep 10;314(15):2750-61
Experimental cell research 2008 Sep 10;314(15):2750-61
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged DST is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to DST on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol