HPA014840

YIF1A antibody from MilliporeSigma / Merck KGaA
54TM, FinGER7, YIF1, YIF1P
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014840
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA014840, RRID:AB_2217189
Product name
Anti-YIF1A antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA014840
Antibody type
Polyclonal
Antigen
Protein YIF1A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ
Storage
-20C
Provider Type Product Number
- No reagents -