Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004633-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004633-M01, RRID:AB_425559
- Product name
- MYL2 monoclonal antibody (M01), clone 3B9-B4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant MYL2.
- Antigen sequence
MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTI
MDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMI
KEAPGPINFTVFLTMFGEKLKGADPEETILNAFKV
FDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFA
AFPPDVTGNLDYKNLVHIITHGEEKD- Isotype
- IgG
- Antibody clone number
- 3B9-B4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Drastic increase of myosin light chain MLC-2 in senescent skeletal muscle indicates fast-to-slow fibre transition in sarcopenia of old age.
Gannon J, Doran P, Kirwan A, Ohlendieck K
European journal of cell biology 2009 Nov;88(11):685-700
European journal of cell biology 2009 Nov;88(11):685-700
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MYL2 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to MYL2 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of MYL2 transfected lysate using anti-MYL2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MYL2 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol