HPA024841

SMG8 antibody from Sigma-Aldrich
C17orf71, FLJ10587, FLJ23205
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024841
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024841, RRID:AB_10600790
Product name
Anti-C17orf71 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024841
Antibody type
Polyclonal
Antigen
Protein SMG8 (Protein smg-8 homolog)(Amplified in breast cancer gene 2 protein) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SINCLFTVPANQAFVYIVPGSQEEDPVGMLLDQLR
SHCTVKDPESLLVPAPLSGPRRYQVMRQHSRQQLS
FHIDSSSSSSSGQLVDFTLREFLWQHVELVLSKKG
FDDSVGRNPQPSHFELPTYQKWISAASK
Storage
-20C
Provider Type Product Number
- No reagents -