Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010714-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010714-M01, RRID:AB_606803
- Product name
- POLD3 monoclonal antibody (M01), clone 3E2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant POLD3.
- Antigen sequence
PPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKT
YLDGEGCIVTEKVYESESCTDSEEELNMKTSSVHR
PPAMTVKKEPREERKGPKKGTAALGKANRQVSITG
FFQRK- Isotype
- IgG
- Antibody clone number
- 3E2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Proteome-wide analysis of SUMO2 targets in response to pathological DNA replication stress in human cells.
Replication stress activates DNA repair synthesis in mitosis.
Bursomanno S, Beli P, Khan AM, Minocherhomji S, Wagner SA, Bekker-Jensen S, Mailand N, Choudhary C, Hickson ID, Liu Y
DNA repair 2015 Jan;25:84-96
DNA repair 2015 Jan;25:84-96
Replication stress activates DNA repair synthesis in mitosis.
Minocherhomji S, Ying S, Bjerregaard VA, Bursomanno S, Aleliunaite A, Wu W, Mankouri HW, Shen H, Liu Y, Hickson ID
Nature 2015 Dec 10;528(7581):286-90
Nature 2015 Dec 10;528(7581):286-90
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged POLD3 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to POLD3 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol