PAB20786

GJC3 antibody from Abnova Corporation
CX30.2, GJE1

Antibody data

Product number
PAB20786
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20786, RRID:AB_10983994
Product name
GJC3 polyclonal antibody
Provider product page
Abnova Corporation - PAB20786
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant GJC3.
Antigen sequence
RTWKHKSSSSKYFLTSESTRRHKKATDSLPVVETK
EQFQEAVPGRSLAQEKQRPVGPRDA
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -