HPA015024

GJC3 antibody from MilliporeSigma / Merck KGaA
CX30.2, GJE1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015024
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA015024, RRID:AB_1847132
Product name
Anti-GJC3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA015024
Antibody type
Polyclonal
Antigen
Gap junction gamma-3 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RTWKHKSSSSKYFLTSESTRRHKKATDSLPVVETK
EQFQEAVPGRSLAQEKQRPVGPRDA
Storage
-20C
Provider Type Product Number
- No reagents -