HPA015024

GJC3 antibody from Atlas Antibodies
CX30.2, GJE1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015024
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015024, RRID:AB_1847132
Product name
Anti-GJC3
Provider product page
Atlas Antibodies - HPA015024
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RTWKHKSSSSKYFLTSESTRRHKKATDSLPVVETK
EQFQEAVPGRSLAQEKQRPVGPRDA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -