HPA003074

HORMAD2 antibody from Sigma-Aldrich
CT46.2, MGC26710
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003074
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003074, RRID:AB_1850916
Product name
Anti-HORMAD2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003074
Antibody type
Polyclonal
Antigen
HORMA domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLSHCITIHKASKETVFPSQITNEHESLKMVKKLF
ATSISCITYLRGLFPESSYGERHLDDLSLKILRED
KKCPGSLHIIRWIQGCFDALEKRYLRMAVLTLYTD
PMGSEKVTEMYQFKFKYTK
Storage
-20C
Provider Type Product Number
- No reagents -