HPA014743

ARL6IP6 antibody from Atlas Antibodies
MGC33864
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014743
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014743, RRID:AB_1845030
Product name
Anti-ARL6IP6
Provider product page
Atlas Antibodies - HPA014743
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGD
SWGEGEVDEEEGCDQVARDLRAEFSAGAWSEPRKR
SVLPPDGNGSPVLPDKRNGIFP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -