ABIN633208

antibody from antibodies-online

Targeting: ZCCHC17 HSPC251, pNO40, PS1D

Western blot

Antibody data

Submit

Validation data

Product number: ABIN633208 - Provider product page
Provider: antibodies-online
Product name: anti-Zinc Finger, CCHC Domain Containing 17 (ZCCHC17) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: ZCCHC17 antibody was raised using the middle region of ZCCHC17 corresponding to a region with amino acids CFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKH
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

ZCCHC17 protein structure - ABIN633208 shown in red.