HPA016862

SLC25A20 antibody from Sigma-Aldrich
CAC, CACT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016862
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016862, RRID:AB_1857028
Product name
Anti-SLC25A20 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016862
Antibody type
Polyclonal
Antigen
Mitochondrial carnitine/acylcarnitine carrier protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREG
ITGLYR
Storage
-20C
Provider Type Product Number
- No reagents -