HPA016862

SLC25A20 antibody from Atlas Antibodies
CAC, CACT
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016862
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016862, RRID:AB_1857028
Product name
Anti-SLC25A20
Provider product page
Atlas Antibodies - HPA016862
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREG
ITGLYR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -