H00023268-B01P

DNMBP antibody from Abnova Corporation
ARHGEF36, KIAA1010, Tuba

Antibody data

Product number
H00023268-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023268-B01P, RRID:AB_1673783
Product name
DNMBP purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00023268-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human DNMBP protein.
Antigen sequence
MTLLSSQSSSLVAPSGSVSAENPEQRMLEKRAKVI
EELLQTERDYIRDLEMCIERIMVPMQQAQVPNIDF
EGLFGNTQMVIKVSKQLLAALEISDAVGPVFLGHR
DELEGTYKIYCQNHDEAIALLEIYEKDEKIQKHLQ
DSLADLKSLYNEWGCTNYINLGSFLIKPVQRVMRY
PLLLMELLNSTPESHPDKVPLTNAVLAVKEINVNI
NEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIK
KSNRVSSHLKHLTGFAPQIKDEVFEETEKNFRMQE
RLIKSFIRDLSLYLQHIRESACVKVVAAVSMWDVC
MERGHRDLEQFERVHRYISDQLFTNFKERTERLVI
SPLNQLLSMFTGPHKLVQKRFDKLLDFYNCTERAE
KLKDKKTLEELQSARNNYEALNAQLLDELPKFHQY
AQGLFTNCVHGYAEAHCDFVHQALEQLKPLLSLLK
VAGREGNLIAIFHEEHSRVLQQLQVFTFFPESLPA
TKKPFERKTIDRQSARKPLLGLPSYMLQSEELRAS
LLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGV
IKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNPR
RSHSDASVGSHSSTESEHGSSSPRFPRQNSGSTLT
FNPSSMAVSFTSGSCQKQPQDASPPPKEWDQGTLS
ASLNPSNSESSPSRCPSDPDSTSQPRSGDSADVAR
DVKQPTATPRSYRNFRHPEIVGYSVPGRNGQSQDL
VKGCARTAQAPEDRSTEPDGSEAEGNQVYFAVYTF
KARNPNELSVSANQKLKILEFKDVTGNTEWWLAEV
NGKKGYVPSNYIRKTEYT
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.