HPA018096

PLPP6 antibody from Sigma-Aldrich
FLJ46512, FLJ90191, PDP1, PPAPDC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018096
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018096, RRID:AB_1855609
Product name
Anti-PPAPDC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018096
Antibody type
Polyclonal
Antigen
Presqualene diphosphate phosphatase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PAHNQMDMFVTLSVDKYSFPSGHATRAALMSR
Storage
-20C
Provider Type Product Number
- No reagents -