HPA014773

TSPAN14 antibody from Sigma-Aldrich
DC-TM4F2, MGC11352, TM4SF14
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014773
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014773, RRID:AB_2208670
Product name
Anti-TSPAN14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014773
Antibody type
Polyclonal
Antigen
Tetraspanin-14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LFQDWVRDRFREFFESNIKSYRDDIDLQNLIDSLQ
KANQCCGAYGPEDWD
Storage
-20C
Provider Type Product Number
- No reagents -