HPA029883

FAM185A antibody from MilliporeSigma / Merck KGaA
MGC35361
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029883
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029883, RRID:AB_10601903
Product name
Anti-FAM185A antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029883
Antibody type
Polyclonal
Antigen
family with sequence similarity 185, member A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PCSGWELGCFRLCLRQVRLWAGAGRWACWACQARP
YSSGGSERWPGSETEVPPP
Storage
-20C
Provider Type Product Number
- No reagents -