Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184097 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DDX47 antibody: synthetic peptide directed towards the N terminal of human DDX47
- Reactivity
- Human, Mouse, Bovine, Canine, Xenopus
- Host
- Rabbit
- Antigen sequence
MAAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVL
CEACD QLGWTKPTKI- Vial size
- 50 µg
Submitted references Viral infections and prolonged fever after liver transplantation in young children with inborn errors of metabolism.
GABAA receptor-associated protein (GABARAP) induces apoptosis by interacting with DEAD (Asp-Glu-Ala-Asp/His) box polypeptide 47 (DDX 47).
Huang HP, Chien YH, Huang LM, Ni YH, Chang MH, Ho MC, Lee PH, Hwu WL
Journal of the Formosan Medical Association = Taiwan yi zhi 2005 Sep;104(9):623-9
Journal of the Formosan Medical Association = Taiwan yi zhi 2005 Sep;104(9):623-9
GABAA receptor-associated protein (GABARAP) induces apoptosis by interacting with DEAD (Asp-Glu-Ala-Asp/His) box polypeptide 47 (DDX 47).
Lee JH, Rho SB, Chun T
Biotechnology letters 2005 May;27(9):623-8
Biotechnology letters 2005 May;27(9):623-8
No comments: Submit comment
No validations: Submit validation data