HPA014855

DDX47 antibody from Sigma-Aldrich
DKFZp564O176, FLJ30012, HQ0256, RRP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014855
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014855, RRID:AB_1847567
Product name
Anti-DDX47 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014855
Antibody type
Polyclonal
Antigen
Probable ATP-dependent RNA helicase DDX47 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLI
GKKLPGFPTQDDEVMMLTERVAEAQRFARMELREH
GEKKKRSREDAGDNDDTEGAIGVRNKVAGGKMKKR
KGR
Storage
-20C
Provider Type Product Number
- No reagents -