HPA014855

DDX47 antibody from Atlas Antibodies
DKFZp564O176, FLJ30012, HQ0256, RRP3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014855
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014855, RRID:AB_1234130
Product name
Anti-DDX47
Provider product page
Atlas Antibodies - HPA014855
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLI
GKKLPGFPTQDDEVMMLTERVAEAQRFARMELREH
GEKKKRSREDAGDNDDTEGAIGVRNKVAGGKMKKR
KGR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -