H00006159-B02P

RPL29 antibody from Abnova Corporation
HIP, HUMRPL29, L29, RPL29P10

Antibody data

Product number
H00006159-B02P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006159-B02P, RRID:AB_1237939
Product name
RPL29 purified MaxPab mouse polyclonal antibody (B02P)
Provider product page
Abnova Corporation - H00006159-B02P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human RPL29 protein.
Antigen sequence
MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGV
DPKFLRNMRFAKKHNKKGLKKMQANNAKAMSARAE
AIKALVKPKEVKPKIPKGVSRKLDRLAYIAHPKLG
KRARARIAKGLRLCRPKAKAKAKDQTKAQAAAPAS
VPAQAPKRTQAPTKASE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -