HPA016422

KCNA4 antibody from Sigma-Aldrich
HK1, HPCN2, KCNA4L, Kv1.4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016422
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016422, RRID:AB_1855574
Product name
Anti-KCNA4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016422
Antibody type
Polyclonal
Antigen
Potassium voltage-gated channel subfamily A member 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKK
FRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQG
KGDDSETDKNNCSNAKAVETDV
Storage
-20C
Provider Type Product Number
- No reagents -