HPA018527

GET1 antibody from Sigma-Aldrich
CHD5, WRB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018527
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018527, RRID:AB_1858860
Product name
Anti-WRB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018527
Antibody type
Polyclonal
Antigen
Tryptophan-rich protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMD
EFARYARLERKINKMTDKLKTHVKARTAQLAKIK
Storage
-20C
Provider Type Product Number
- No reagents -