HPA018527

GET1 antibody from Atlas Antibodies
CHD5, WRB
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018527
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018527, RRID:AB_1858860
Product name
Anti-WRB
Provider product page
Atlas Antibodies - HPA018527
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMD
EFARYARLERKINKMTDKLKTHVKARTAQLAKIK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -