H00009033-M01

PKD2L1 antibody from Abnova Corporation
PCL, PKD2L, PKDL, TRPP3

Antibody data

Product number
H00009033-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009033-M01, RRID:AB_1137373
Product name
PKD2L1 monoclonal antibody (M01), clone 4F9
Provider product page
Abnova Corporation - H00009033-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PKD2L1.
Antigen sequence
KWYNNQSLGHGSHSFIYYENMLLGVPRLRQLKVRN
DSCVVHEDFREDILSCYDVYSPDKEEQLPFGPFNG
TAWTYHSQDELGGFSHWGRLTSYSGGGYYL
Isotype
IgG
Antibody clone number
4F9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -