Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009033-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009033-M01, RRID:AB_1137373
- Product name
- PKD2L1 monoclonal antibody (M01), clone 4F9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PKD2L1.
- Antigen sequence
KWYNNQSLGHGSHSFIYYENMLLGVPRLRQLKVRN
DSCVVHEDFREDILSCYDVYSPDKEEQLPFGPFNG
TAWTYHSQDELGGFSHWGRLTSYSGGGYYL- Isotype
- IgG
- Antibody clone number
- 4F9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A novel PKD2L1 C-terminal domain critical for trimerization and channel function.
Zheng W, Hussein S, Yang J, Huang J, Zhang F, Hernandez-Anzaldo S, Fernandez-Patron C, Cao Y, Zeng H, Tang J, Chen XZ
Scientific reports 2015 Mar 30;5:9460
Scientific reports 2015 Mar 30;5:9460
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PKD2L1 monoclonal antibody (M01), clone 4F9. Western Blot analysis of PKD2L1 expression in rat brain.