HPA027103

EYS antibody from Atlas Antibodies
bA166P24.2, bA307F22.3, bA74E24.1, C6orf178, C6orf179, C6orf180, dJ1018A4.2, dJ303F19.1, EGFL10, EGFL11, RP25, SPAM
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027103
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027103, RRID:AB_1859540
Product name
Anti-EYS
Provider product page
Atlas Antibodies - HPA027103
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CECTSGWTGQNCSEEINECDSDPCMNGGLCHESTI
PGQFVCLCPPLYTGQFCHQRYNLCDLLHNPCR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -