Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406086 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Monoacylglycerol O-Acyltransferase 2 (MOGAT2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MOGAT2 antibody: synthetic peptide directed towards the middle region of human MOGAT2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLAL
THGAP LVPIFSFGEN- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A predominant role of acyl-CoA:monoacylglycerol acyltransferase-2 in dietary fat absorption implicated by tissue distribution, subcellular localization, and up-regulation by high fat diet.
Cao J, Hawkins E, Brozinick J, Liu X, Zhang H, Burn P, Shi Y
The Journal of biological chemistry 2004 Apr 30;279(18):18878-86
The Journal of biological chemistry 2004 Apr 30;279(18):18878-86
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting